dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|478471474|ref|YP_007740077.1| (Chlamydia trachomatis L2b/LST)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment transcription antitermination protein NusG [Chlamydia trachomatis L2b/LST]
Sequence length 182
Sequence
MFKWYVVQVFTAQEKKVKKSLEDFKEASGMSDFIQQIILPSENVMEVKKGEHKIVEKYIW
PGYLLVKMHLTDESWSYVKKTQGVVEFLGGGAPVALSEEEIKNILADLEEKKSGVVQKHK
FEVGSQVKINDGVFVNFVGVVSEVFHDKGRLSVMVSIFGRETRVDDLEFWQVEEVVPGQE
SE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]