dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Traes_4DL_614C6B143.1 (Triticum aestivum 22)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:novel scaffold:IWGSP1:IWGSC_CSS_4DL_scaff_14302325:3610:7835:1 gene:Traes_4DL_614C6B143 transcript:Traes_4DL_614C6B143.1 description:""
Sequence length 160
Sequence
MMARRPGAGEERPWKLAEHARLGKGKVVGVVVLDGWGEAPPDPFNCIHVADTPTLDALKK
GAPERWRLIKAHGTAVGLPTDDDMGNSEVGHNALGAGQIYAQGAKLVDLALASGKIYEGE
GFKYIQQSFETGTLHLIGLLSDGGVHSRIDQLQLLLKGAS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]