dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|478463798|ref|YP_007739610.1| (Chlamydia trachomatis L3/404/LN)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis L3/404/LN]
Sequence length 659
Sequence
MSPQLFSSPFSRELLSDFFESGMAEENSPLLSQKNRRLSQNLTLKSAYISLALYLGSLLS
HWIGYQALSSLLLILTFFLAGTPALIKSFEDILDRTVNIDILMTSAAFGSIFIGGALEGA
LLLVLFAISESLGAMVSGKAKSTLASLKHLAPTVAWVVQQDGSLQKVLVQNVKIGEIIRV
KSGEVVPLDGKIIHGASSINLMHLTGEKIPKSCGIGDTIPAGAHNLEGSFDLQVLRIGAE
STIAHIINLVVQAQSSKPKLQQRLDRYSSTYALTIFAISACIAIGGSLFTTLPFLGPDSA
FYRALAFLIAASPCALIIAIPIAYLSAINACAKHGVLLKGGVVLDRLVSCNSVVMDKTGT
LTTGDLTCSGCEDFGPESPLFYSCVLAMEQSSSHPIAQAIVNYLTEKQVRSLPATQCTTI
PGEGVSGEFNGEQAFVGRVSTALRYVPEEYREQLRERAQQAQERGDTCSIACLGKRVSLF
YFRDVPRHDAANIVSYLKKNGYPVCMLTGDHRISAENTARLLGIDEVFYDLTPDNKLSKI
QELAKSRQIMMIGDGINDAPALAQATVGIAMGEAGSATAIEAADVVLLNQGLSSLPWLID
KAKKTRRIVSQNLALALAIILFISGPASMGVIPLWLAVILHEGGTVIVGLNALRLLKNT

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]