dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|479193746|ref|YP_007823284.1| (butyrate-producing bacterium SS3/4)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment transcription antitermination protein nusG [butyrate-producing bacterium SS3/4]
Sequence length 171
Sequence
MSEAQWYVVHTYSGYENKVKVDIEKTIENRGLQDQILEVSVPLEEVIELKNGAQKQVERK
MFPGYVLIHMIMNDDTWYVVRNTRGVTGFVGPGSKPVPLSEEEMMSLGFKAPDVVVDFAV
GDTVVVTAGAWKDTVGVIRTVNESKQSITINVEMFGRETPVELSFSEIKKM

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]