dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|383319718|ref|YP_005380559.1| (Methanocella conradii HZ254)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein Mtc_1287 [Methanocella conradii HZ254]
Sequence length 262
Sequence
MDTLEKAIKFLMGSQRADGSWGNGDPFVCARVMLALKDDAPEGMLLKGLKYLEGRQETDG
HFKPVGGMYSDATSTAYALIVLNKFDYGKASLPVSRGIVWLVESQNKDGSWGKNKEKKAY
TTTFCLRALHAFYLSGINRFARGLEFSLGYLRGLDFSREPVSHVYAPILNLYRMSYLDEG
LRDKFFEFALDAAEPALEGGSVADVAYLLGTLKALGEADVSAALEEWLAAAQHDDGSFGK
DLASPGDPNWTALVALAIKGML

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]