dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|397781754|ref|YP_006546227.1| (Methanoculleus bourgensis MS2)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PAS/PAC sensor protein [Methanoculleus bourgensis MS2]
Sequence length 630
Sequence
MSPGQEITGRILRTLRFRSKGMTITEIARALGMNRNSVSKHLEVMQVAGQVESRLVGNAK
VYSVAQRVPLSAFLCFTQNPILILDANLTIIQANDQLLRHFGRTKEDLLGQNIRDTALPA
VSTQEALAVIEGLEREQVITDVCCRNDSGRESFYQMQVIPTTFEDGEKGCTIVFEDITER
KRYIQNTMFLARTAMDLVDLPPVGDIYQYIVDRLTELVPGARIYLFAHDEVDRQFVVRAV
AGEGFREGLTELLGRDPVGLVLPVARAFDAPYHQTPHVMRGMQEFALRPEPSSWPFYDLC
FRAIPEGVCEAILSRYNIGTLWAAGLVWREQLFGIVGIFLEQGKDLENQETVESFIRQVS
IALARRQIEGRLRRNEERFRGMVDSSPFAVALINQEGRFVYVNRKFVEVFGYGPEDAPTC
SEWFRLVFPDAGYRQEAVKAWRLDLERSVTGQVRPRAFTVRCRDGSRKVILFRAVTLPDG
TQYLTCEDITEEARTYRLLLADIADLRHREQEMLLKDRAIASTGRAVALLDPDGVVTYAN
QAYLALWGYRTAADVQGSHFSRFWEPPDGAREVVRAALEGEVWHGELTGIRSGGETFRVD
LLGTPIIGRDGRVLGMMAAVTAGRVKDERS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]