dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|386001425|ref|YP_005919724.1| (Methanosaeta harundinacea 6Ac)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment Peptidase domain protein [Methanosaeta harundinacea 6Ac]
Sequence length 681
Sequence
MKGIFRRSAPGLIYATFVLLMLATLGYSQMDPNEPNSELGSATWISPGVSAAGTINPAGD
VDFFGFEVESPGVLEVKLNALPHDMRARIDLYGKNFNFITRKDASNPGDLVALTLDLASP
GRYYFGIVDLAGKSHDTGYSFDLSFGPVVDVNEPNGEAGDAKSVGFGDLILGYIFPKGDA
DIYKLNVTGSGILEVKAESVPEGMKTRIDLYGKNFNFITRVDASNPGDLVTLKHDVVNPY
SWYPVSYYVGITDLSGGSYHVPYTFKADFEPVIDENEPNGEIGDAVAIAFGDQIEGYIFS
KGDVDFFKFEAPSPGILEVKTASVPEEMRTRIDLYGKSFNFITRIDASNPGDKTTLRFDV
KSPGVYHIGVVDLAGRSHKVPYSFAASFEPVVDDNEPKSEIGDAAPISPGEAVGGVIFPA
GDVDFYKIWADSPGDLEVMLESVPDEMRARIDLYGKNFNFITRADASNPGDLATLKYGAP
GPGWYYIGIVDLAGRSHSTGYSFRAVGGGLGGSGSGPQEGGAVGTKAGGVKVVSDGTANG
TATSYREATLTHSGFDFSLGETGEYPTFDGEIITWQPSAEDHPDYPRDAGYLWWRNTHLD
DQNRVSQTRDMGSVDLEAVRTVPAEWDRSPLIPPLLEGHTIVARCNDGYVKFQVISVDPE
AESVVVRYFHSPDATFDDGAS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]