dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|389864036|ref|YP_006366276.1| (Modestobacter marinus)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment GntR family transcriptional regulator [Modestobacter marinus]
Sequence length 234
Sequence
MSGPDALTRSVLADQVKERLLEAILDGSYPPDSRIVETAVAKELGTSQAPVREALRGLEA
LGIVEITPFRGARVRRLDVAELLEAYVVRSAIEVLGARLAVARLTDDDVAAIARIGEDMR
RVADAADGRALAIVDASFHEKIMSLSGNSTLLRVWRSLEPMSRTYITLVGPNSDPQWTCG
LHDPILEGIHRRDADAVVAAIERHFDQVRERLAGSLAGVAEQQDSAAQPATGTS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]