dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WUBG_13590T0 (Wuchereria bancrofti v1.0)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment | WUBG_13590 | Wuchereria bancrofti hypothetical protein (279 aa)
Sequence length 279
Sequence
KGCEPCECDPTGVILSDNGMPQLQCNELDGRCYCKPGRGGRTCSDCEDYHWGDPATGECR
KCECDRIGSATQQCDRNNGSCVCLPGSGGPLCNMCARGYTGQWPQCQACGECFQNWDEII
QNLRSQVEVLIETAKNVEDTGVASVYDNEFEKWKTINLKKELLNSVGGRITEISSNVDGA
DLELKSLVEEADRLTEKSQAFQENATLLRVADIQGAYNITRESAEKSSAAKLRTDQADLK
ITSAESSRQEATQLLDNNQLDFEKQFSENEMALVRIDKQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]