dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|379747044|ref|YP_005337865.1| (Mycobacterium intracellulare ATCC 13950)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment metal cation-transporting p-type ATPase C [Mycobacterium intracellulare ATCC 13950]
Sequence length 751
Sequence
MTVVDDAVLPVVSDAGGRMRVVVPWVRANSRRAVAVEESVGRQHGVRAVHAYPHTGSVVV
WYSPRRCDRSAVLRAITEAAHIAENLIPARSPRSADVRNTEVLRMVIGGAALALLGVRRY
GFKRPPLLSPTGQLVATGVTIFTGYPFLRGALRSLRSGRAGTDALVAAATVASLVLRENV
VALTVLWLLNIGEYLQDLTVRRTRRAISELLRGTADTAWIRLNDGSEVQVSIDTVEIGDQ
VVVHDHVAIPVDGEVIDGEAIVDQSAITGENLPVSITAGSPVHAGSVVVRGRLVVRASAV
GSQTVIGRIITRVEEAQLDRAPIQTVGENFSRRFVPASFILSALTLVLTGDVRRAMTMLL
IACPCAVGLSTPTAISAAIGNGARRGILIKGGSHLERAGRVDAMVFDKTGTLTVGRPVVT
NIIALHKDWEPEQVLAYAASSEIHSRHPLAEAVIRSTEERRITIPPHEECEVLVGLGMRT
WADGRILLLGSPSLLRDERVRISKKATEWVDTLRRQAETPLLLAVDGKLVGLISLRDEVR
PEAAEVLKRLRATGIRRIVMLTGDHPETAAAVANELGIEEWRAEVLPDDKLEVVKALQDE
GYVVGMVGDGVNDAPALATADIGIAMGLAGTDVAVETADVALANDNLQRLLDVPDLGARA
VEVIRQNYGMSIAVNAAGLLIGAGGALSPVLAAILHNASSVAVATNSSRLIRYRLSDTAL
GNAGDRDTNTEGSLPLPGGSVRPLVAQESSR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]