dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSXMAP00000010417 (Xiphophorus maculatus 69_4.4.2)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:novel scaffold:Xipmac4.4.2:JH556681.1:2847082:2948457:1 gene:ENSXMAG00000010403 transcript:ENSXMAT00000010431 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 788
Sequence
MAEKLGSAGPKPNNVRTAPPLPPEPIEIIRTKARSRRVRLNVGGLNHEVLWRTLDRLPRT
RLGKLRDCNTHESLMEICDDYSLNENEYFFDRHPGAFTSILNFYRTGKLHMMEEMCALSF
GQELDYWGIDEIYLESCCQARYHQKKEQMNEELRREAETMREREGEGEFDNTCCPEKRRK
LWDLLEKPSSSVAAKILAIISILFIVLSTIALSLNTLPELQVMDEFGQANDNPQLAHVEA
VCIAWFTMEYLLRFLSSPNKWKFFKGPLNVIDLLAILPYYVTIFLTESNKSVLQFQNVRR
VVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEK
DEDATKFTSIPASFWWATITMTTVGYGDIYPQTLLGKIVGGLCCIAGVLVIALPIPIIVN
NFSEFYKEQKRQEKAIKRREALERAKRNGSIVSMNLKDAFARSMEILDVVVEKGEDKTSL
DNHLTPSRLGSSTRHATSESSLRSPDKRNPEHRISRTPQHLSVQKLEEMYNQMTKSQSFT
NLSSMSTLSTTMTVPGSPKKSLSPDSTLKEEVLLEAGDDYGLYEIRHTTIPPLLNFSHLR
CTGNDFYESHNPCDGSDLHTEEGKRFNSAAEITQSSPSENNPPKIKGLKTNFSKSSNEGP
ITPPSTTSPGDISSSVLGDETPTGETSPLIPSSEELIPVTLEGPCSFSPKKLLVDTPPGD
EDQSTDNHEEKQLMEEAGAAVAPLSPKTAAQNCSQGNNPGGHKVENHIFTSSDIHLIPGD
GSLSPTCE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]