dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|165971387|gb|AAI58508| (Xenopus (Silurana) tropicalis v7.1 (annotation v7.2))

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment was protein [Xenopus (Silurana) tropicalis]
Sequence length 476
Sequence
MSRGGPKAAVRQQDNVSSSLLLPQENQKVFQLLGRKCTTLATTVVQLLVAQGGDRWAKQF
LGVLCLVKDNPRRSYYFQLFDLQEEKAVWEQELYEQLRYLPARPYFHTFCSDECQTGLNF
ADEAEAADFQVVVEEKLKKKQHRQDRRQNLPPPPPVSDDRRTSLPLPPPPGPGPFPNGPS
SPQPLAPSQSLNMPAVSIPNPDITSARYRALSAPADKGKNKKGKKKFSKADIGAPSGFKH
VSHVGWDPNSGFDVNQLDPDIRNLFSRAGISDAQLKDAETSKLIYDFIEQQGGVEAVKNE
MRRGETAPPPPPPSRNAPPAPTPSRGRTGPLPPPPVRGSSAPPPPPPSRSTPPIPPPTAR
SGGPPPPPPPPPSIPAPPPTSGPAPPPPPPVSGTQSIPSPTPSGGRGALLDQIRQGTKLN
KLTVSAEPPPSPQPSSEGLVGALMHVMQKRSKAIHSSDDDDDEDGADDDEDDEWDD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]