dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|301607900|gb|XP_002933538| (Xenopus (Silurana) tropicalis v7.1 (annotation v7.2))

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PREDICTED: toll-like receptor 2 type-2-like [Xenopus (Silurana) tropicalis]
Sequence length 831
Sequence
mrgleernervrreeresykrgtrelqernervtreewvlekysttwalpinpnktkmvf
qkknskqsqtpsfllnnralshtdrcfstsvmyiysiciiyllaiaelskgntdcpcdaa
hfchcssmhweaipsglprdvrglnlssnaiqivtetdlkpydqlqtlllqynaihtind
gsfqplgnleeldlsynnlvllssvwfrnlnklkhlnllgnqyitlgndslfaslsslss
lqfgnqnfdaiqkqsfeglerlntleinaaqltlyeegslgrmkqiyhtilrvnltllpa
llkdlvhsvtlleitdtefstpadmqafevlaytsvkqfifrnctivdvsgyrfveiiqt
yrnitdvvmkncrllgrgldcpnlkrttssvttiiinnievslyyifsdlsslhqiipqf
tyvtvtdspvylipcqfsqsftslqyldvsggkldntylgssvcyhegggacpklqtlnv
srnlltsvpkvaqflsglnyltnldisqnkfselstskcqwpknlkylnisnnqiniitt
cipptlqildvssnyltvfaiempnltelyisnnrlsklpegmyftslvllsisrndlng
fgqsdlelfsnlkdvqiqdanlpplvchktlivtlscillialvaaivalchflhvvwya
kmtwawlkakrkplkncdreicfdgfvsyserdsewvenmmvpklenatlamklclhkrd
fvpgkwiidniidameksyktvfvlsehfvrsewckyelefshfrlfdenndsaililld
pieketvpkrfcklrklmntktylewptdeeqqevfwdnlktalqpadyin

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]