dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|302873880|ref|YP_003842513.1| (Clostridium cellulovorans 743B)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment glycoside hydrolase family protein [Clostridium cellulovorans 743B]
Sequence length 532
Sequence
MKKIMKLSTTAIALTSLLVTPSIKVCAETTTPVAETNDDWLHVEGTNIVDKYGNKVWLTG
ANWFGFNCRERMFLDSYHSNIIADIEMVADKGINVVRMPIATDLLYAWSKGEYPESTDTS
YNNASLAGLNSFQLFNFMLQNFKRVGIKVIVDVHSAETDNMGHSYPLWYKGAITEDVFKS
SWVWFADQYKNDDTIIGFDLKNEPHTNPGDAKNLSQCAIWDDSTKANNWKRVAQETALDI
MNVHPNALIFVEGVELYPKDGTWDEGTINTSPWAGNNDYTSNWWGGNLRGVKDYPINLGE
YQKQLVYSPHDYGPLVYEQSWFKGDFVTADDATAKTILYEKCWRDNWAYIMENGTSPLLI
GEWGGLTEGTDKLLDVNLKYLRSMRDYIIANKYKLHHTFWCINTDSSDTGGLLTRGEGTA
FPGARDLKWNDNKYDNYLLPTLWRNDEGKFIGLDHKIPLGKNGITLGTSIVINPPLLGDI
NKDGKVNAIDLAVLKKALLGTGTTPDLAVADMNNDGKINAIDLAVLKKKLLS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]