dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|302875410|ref|YP_003844043.1| (Clostridium cellulovorans 743B)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment G-D-S-L family lipolytic protein [Clostridium cellulovorans 743B]
Sequence length 453
Sequence
MLKTKKLVGVAMTLVATLTLSLSSSLFSTLEVKAVDQVTSSETTVVEDTHSNMPLISRSV
PAFSSTSGASNANDNNYGTTWYGTAPGWLAYDLSNVPVEQREKIVLSWYNSDTYDYDSSI
LNTSSYHKPKSYTIEGNSASGGNSAPASGWVVLQTVTNNNYHSREHVLDFSGYNWIRINI
TDSIPGSISINMDIHNAKQGTDDAWIILGDSITAGGTALNGNGKGTIAQIVNSYNPNHYP
LVECGGTGSILSRHLVQNIKSYLSIFPGKYVGVAFGTNDSWGNQTGADNYYNNIEYAVKE
ILAAGKVPIVSKIPWARLNNVSDNVPAYNAKVEAIYSAYPQVIKGPDFWTIFKENQTLIS
GDNVHPSTEGYNRMREAWAETILNVYKNSTVVIKKGDVNNDGKVNAIDLAILKKHLLSGG
LTGDALKASDMNNDSVVNAIDLALLKKILLSQA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]