dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|302876911|ref|YP_003845544.1| (Clostridium cellulovorans 743B)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment Dockerin type 1 [Clostridium cellulovorans 743B]
Sequence length 946
Sequence
MVKGRKKAIGCLAMTAAITASTIQMPLVAANAETTATPVRYEAEKATLTGTEVKTGTIFS
NGAGVDGFDTAGDAVTFNVNVEQAGRYNITIGYATPYGQKNNTLVVNGSVISDCVFPASD
TVKQLTVNNISLKAGANTIAIVNSWGWMQVDYIDVQLGEARGPLTPVQPNLVNPYASTST
KALMKYLTDNYGSKIITGQQSGGLDEINYIYSLTGKLPAIQGFDILSGDADIEKAKTWAS
YGGIVELCWHWRAPSGGSDFYTNGTTFDITKAVTPGTAENALILKDIDATAAKLKVLQDA
GIPVLWRPLHEASGGWFWWGAKGAEPLKQLYKILFDKLTNEYKLNNLIWVWTSGTDASAS
TWYPGDAYADIIGVDNYPQTPDHGSFVNSFDTLVALGAKNKLVTMSENGPIPDTDNLQAD
GAAWSYFSTWSGKFIMDEKENTSDLIKKVYTSDYALTLDEIPSASIYGKAPLPVWAAKPL
PTAAPIPEGYTVFEAEKAVLSGLTVDNSNKGYSGTGYVGNFGGATDNLSLNVTVDKGGEY
SLIVRHSAPYGSKEYNVLVNGAVVATNKIQESSLFTDSTAVTVKLTAGANTIKIDRGWGW
FNVDCLMLKPLNGQVIGGPTTQVIPEGYTAYEAENATLTGVEVGNTTKGFSGTGYVTSIT
DDTDKVDFKVNVKEGGTYSLLVRHAAPYGDKAYNVLVNGTQAGTNNITESTEFSNSAELK
IELKAGDNTITIDRGWGWYELDAIMLKALSTRPELTIPEGYTVYEAEKGTLNGTAVATAM
QGFSGTGYVTSFEDDTDNLAMNVNVAAAGTYNLIVRHSAPYGAKEYNVLVNGTAVATNKV
AESTYFSDTTPIEIKLNAGDNTITIDRGWGWFNVDLIMVKPVSVVTTYSLGDVNKDGKVN
AIDLAFVKKAILNGTTDSMDLTVADMNKDGKINAIDLALLKKKLLS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]