dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|302347984|ref|YP_003815622.1| (Acidilobus saccharovorans 345-15)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein ASAC_0184 [Acidilobus saccharovorans 345-15]
Sequence length 310
Sequence
MRAEVETGSRLHGGFYYAAGDWNVRWGSIGFYVDNPKFRAAVELSDREQYRGPQELLEYV
KKAAKVAGVQGFNVEVHESPPIHRGFGTGTQVLLSLYMAFKALKGEQPEAVEEAALKLGR
SRHSGAGTLAFKYGGFVMDAGLPGRPTPLVTLKMPSEWRFVIIIPKIERGLTDEEEESIM
EKRQWGNSESNIAFMTSGALRLAAGIARGDLDDALEGLRFVQRGTGILFASVQGGEYRGK
LNDLAAEAWRSRVILAQSSWGPAMYTIVENEYEAQGDVMLMKEIMSNVGLSGEVIISPPR
NYGASIKIVG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]