dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

AGAP000974-PA (Anopheles gambiae 49_3j)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:novel chromosome:AgamP3:X:18738556:18759867:1 gene:AGAP000974 transcript:AGAP000974-RA
Sequence length 819
Sequence
CFEGEVERLLKEHQQNQELVDKIGSSYYQIIYPVQLRHHEKMGISTREVNQPKTGKHFHR
TSLLIKAFNHKFRLDLELNTQLLAPNIVQKHYLPSGFAQDSHREIEHCYYHGTVKDYPGA
SAAFHTCNGVSGVIHVGNETFVIHPFYGGDLSKHPHVIFEARTKSNKGCANSGNLEWRTR
SIRRGSSHHAGLVELIDRNGAGRYRRDVRETTKYIETALIIDKAMFQKRNGSTRTEVVHD
AIQVANIADLYFRTLNTRVSVVYIETWQGQNQAQIDGGKDISKAISNFNDYTSRNLYKID
KDTTQLLTGETFAGGEVGMSVPETVCTPKAVGISVDMNPYEPHLLAGTMAHMIGHNIGMG
HDDNRDECICRDWHGCIMSQSIVGLENVQPYKFSECSRLDYIDALRIGHGLCLLNKPNEV
ELRKNCGNGIVEDDEECDCGSALDCDKTDPCCDGITCKLKKESQCATGPCCDKCILKPPG
VICRDAHNECDLPEYCNGESGQCPPDVHKKNGNPCGMNSTGFSTGYCFNGVCPTQAAQCE
RIWGYSGTGADRVCYEQFNSKGSINGHCGKDANGNYIKCEPENIQCGSLQCKDGDRTPVE
DCCEHLYSRAIISIRGTEYECKSITGASTNSNTPPYGLVRDGTPCGDNLICVNQTCVSIF
PYIDQTKCPTNHNNLECSGNGDCTNNNKCFCKFGWTGPDCSIQAHITTTYPSLITSTTSE
STIIMEKKTTRYANYHGSNTVFLVGVLMSVVGGVFITFALMALCYRSKTTRLKYDPPYVK
KPMAKYVGGATAANHHSQDDVSLEGSNKMMFGNQTTQFR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]