dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|300702482|ref|YP_003744082.1| (Ralstonia solanacearum CFBP2957)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment copper transporting P-type ATPase [Ralstonia solanacearum CFBP2957]
Sequence length 749
Sequence
MTTASLADAASLDLEIQGMTCAACAGRVERALRAVPGVVAASVNLATERARIQRTDDVSG
DALVAAVVAAGYEARIASDEVTAAPAAVEPGFWDGPGPVWVSAALSLPLVAPMVAGWLGA
GWMLPAWLQWLLATPVQGVIGARFYRAGWKALRAGAGNMDLLVALGTSAAYGLSLWLWWR
ADAGDMPHLYFESAAVVITLVRLGKWLEARAKRQTAQAIRALQALRPDTARVRGADGTLR
DVPVARVRVGDAVSVRAGERIPVDGTVVEGASHVDQSMLTGESLPVPKRAGDHVTAGAIA
ADGVLLVRTTAIGADTMLSRIIRLVEDAQAAKPPIQQLVDRVSAVFVPVVLAAALVTLTG
WMIAGAGWEHAIVNAVAVLVIACPCALGLATPSAIMAGTGAGARRGILIADAQALERARQ
VDFVVFDKTGTLTVGQPRVAAVEAAPGLDGDAVLDQLAALQAEHTHPLAQATRDHAAARG
RTIAPARSPEVLAGRGVRGVVGGAVLLLGNARWMDELRLDRTRLQARADALEAQGHTVSW
LAQGEADGGVRLCGLIAFGDALKPGAREAVAELHRRGIRTALVTGDNAGAARGVAEALGI
DAVAAQVLPQDKAARVAAWQQSGHVVAMVGDGINDAPALAAADVGIAMATGTDVAMQAAG
ITLMRGEPRLVPAALDLSQRTVAKIRQNLFWAFVYNVVGIPLAACGLLSPTFAGAAMAFS
SVSVVTNALMLRRWRPRWESATATGDRAS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]