dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|255767554|ref|NP_390356.2| (Bacillus subtilis subsp. subtilis str. 168)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment RsbT co-antagonist protein RsbRD [Bacillus subtilis subsp. subtilis str. 168]
Sequence length 278
Sequence
MIALDQHLTEHKKDITQQWLEVCTSNGSWLYSAKDQQKLEQKLKDQHELLVTIVAKSLRK
EDVEDELNRWSLQCARDRAVHEVTVTQSVGQFNTFRHIMFEWIHKFSEASSQDISIQEFY
EWSRILNQNIDEIIEVFTEEYHQVTMIQLNAQKEMINELSAPIMPITDGIGILPLVGEID
THRARTILESVLEQCSALKLSYLFLDISGVPIVDTMVAYQIFKVIDSTKLLGIETIISGI
RPEIAQTVVKLGLDFSNVKTEQSLAKALANKGFKIKEC

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]