dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSBTAP00000039420 (Bos taurus 69_3.1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:known chromosome:UMD3.1:15:77516535:77521982:1 gene:ENSBTAG00000027557 transcript:ENSBTAT00000039630 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 719
Sequence
MEATEELLLGRGRLQLAPDPRLGPESGWSPPSEGCAPGLKDVPPGPTRAILALKSLPRGL
ALGPSLTAEQRLGVWCVGEPLQPGLLWGPLEEGSVSEQKGNGVEPKRKEDVSLGSWGDVC
ACEQSAGWTSFVQLGRLEGEGNVAPVRIGERLHLRVSRRVLPGFELRLWPQLPSEGPSPP
QPRLEEASSAAVVTEVESAVRQEVACPGEDAAEPCPDPGHQSPPSIQAESVVSPGLTPQT
QPPVPKENQPLGPLPADDSVDEEDPPQTQTPPEPQSSSAPQQGPARGEASSSSSDRAPQL
CAHLVKKLRSPSGQHPPRAKTSEPGAQATGEPQRPGFPARLRSPPGPAGGSPKQGRRYRC
GECGKAFLQLCHLKKHAFVHTGHKPFLCTECGKSYSSEESFRAHTLGHRGVRPFPCPQCD
KAYGTRRDLREHQVVHSGARPFTCEQCGKAFARRPSLRLHRKTHQAAAAPTPCPCPVCGR
PLASQGSLRNHMRLHTGEKPFPCPHCGRAFRQRGSLRGHLRLHTGERPYRCPHCADAFPQ
RPELRRHLISHTGEAHLCPVCGKALRDPHTLRAHERLHSGERPFPCPQCGRAYTLATKLR
RHLKSHLADKPHRCPTCGMGYALLQSLRRHQLSHQPGAPASLPCEPPATSEPTVVLLQDA
GSEGDGTPARDIFEVTISQSQEKCFVAPEEPGPAPGLVLIHKDLGFSTWAEVVEVETGS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]