dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|397678152|ref|YP_006519688.1| (Mycoplasma wenyonii str. Massachusetts)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment ribonucleotide-diphosphate reductase subunit alpha [Mycoplasma wenyonii str. Massachusetts]
Sequence length 709
Sequence
MINKSQKITNPSYYNSLIFNNQVTLKGEDGFFCLEKDKLAIQEYQKYISECEKYSHKRRG
FERIKWLIETEYYLSQLIEKYSETQINQLTEEVYGAGFQWKSYISISKFFESFALRSNCG
KYILESYEDRVIVTSLFLADGDFELARKIANLIIKQIYQPATPTFSNAGKKRSGMLVSCF
LLEAEDSINSINYIISTSMQLSKIGGGVAINLSKLRGRGASIKQIDSTASGIFPVLKILE
NVFDYADQLGMRRGSGAVYLNIFHYDLIDFIDCKKINADEKSRIQTLSIGLIVPDKFLQL
ATENKNFFIFEPNTIYQKYRLSLPDLDFNYWYDILANDDSLLKKELSARAVLTKIAQIQF
ESGYPYVIFIDNANKKNPLKNIGKIKMSNLCTEIFQNQESSTIGDYGLGDIIRNDVSCNL
ASLNLVNVFEDGNLEEIADLSMRALSAVSDLTSITNAPSIRKANEEFKSVGLGVLNFTGL
LLKNGLEYDSPETLEIADVFFAALNYYSLLASSRIAQERKISFKEFENTDYFTGAYFEKY
ISHPYLPKSEKAKEIFKNMKLPTPEDWANLKELVKKNGIYNAYRLAVAPTQSISYLQGAT
ASIQPIISPIETRMYGSSITYFPMPFLNKDNHHLYKSAYLIDQKKLIDLSAIIQQHVDQG
ISTVLYVTNNSTTRDLVKLYLYAHHKGLKSLYYVRTKNLQPTECVSCQA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]