dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|297527286|ref|YP_003669310.1| (Staphylothermus hellenicus DSM 12710)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment GHMP kinase [Staphylothermus hellenicus DSM 12710]
Sequence length 424
Sequence
MADKDPTRYIVSEYKRFYGLEPEVIVSAPGRLDFLNTHQDYKGLPVVSIGINLRTYVAIS
RSPSNYSRIISLNMLWEDKGFQDIFRVENTFLRMDKWFGNYIRASMIALKQCCGSIGDVW
ALIYSDIPIGAGLASSAALLVAFIGGVNELYGLGLDRRDVAELAYHVEHDIMNIPCGRLD
QYGSAYGGIVRIETKPPYNVEELQRINGVFVVLDSGIKHSTADIHPLRQAEINTGLRLLL
QMNDLDRRVREKLAREYYAVKWDMIRYEEIKPYLYRLPVIPRKRIEFTFKMNDSTRLALE
VLKGGIPSFEKWVTVLGWGWRDKILEAMKNSDPVLSLIGLTMNYQHILLRDLYDVSLPQI
EKIRDAALSAGGLGAKISGAGLGGSLIVLAKDRGTAEKILRKALDNGAVRGWIVEIDSGL
RREA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]