dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|302336332|ref|YP_003801539.1| (Olsenella uli DSM 7084)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment proteinase inhibitor I4 serpin [Olsenella uli DSM 7084]
Sequence length 451
Sequence
MERPIERRTALALLGLPLALSLGSSLAGCGVGGNPDDVPPLLAASDLTAGVGDSASVRGA
QAPIGDTLTDQAATLAAYDFAARLLQGCYKAEPGGNVLVSPLSALFALALAENGAAGETL
SQMEAATGMGVRDLTSYLEAYARRIGGEPLYDTQGTGEALALRSANSVWLRDSGGLSVTD
DYLATCKDDLFAQAFSAPFDETTRRDINSWVSSKTDGMIEGMVDEISDEARLFLINALAF
DGAWSDPYKDDDVRDDTFTAVDGTGQDVRMMRSHESHYLENGFAEGFMRPYENHDFAFVA
LLPKGGVGIGDLVGSLDGGSLHELVTGAVPDVEVSAGLPKFTASHRTLLDEQLHSMGMLD
AFEPSLADFSPLGSVPDGNLAVGSVIQKTFVDVNEQGTRAAAATSVEMETTAARPSDPEV
REVVLNRPFVYLIIDYQSATPLFAGVVTSMA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]