dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Y57G11C.5a (Caenorhabditis elegans 69_215)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:known chromosome:WBcel215:IV:14761794:14765401:-1 gene:Y57G11C.5 transcript:Y57G11C.5a gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 535
Sequence
MSNNSKSTESRNKSQTSWNPFRKMLSMVTGRTGSESNSNTSDGEKTILRWTTACLTTTCP
IFSRNPQFNMIYCPVPSLLMYVIITLASENAMTKTLHRLFELTDSDVDEIREMAQKLAEL
QHPKHFYCFIRFLVDEQETTTVSKELMIKSNDVAFQQVFASFRPSRITKFLNSLTFSPVS
LNRPSLLTTNGYGSAGLNATWIGKTRKAGLNRFACTYHKKKNEEFFEIRTAYRTINMEQF
QVFEIPFKFGLSSACFGSLLILRPHLIGSLPYANRQLTTQSLSKMLDELYTAQWITEGRL
LLPQFSVDSCHDLWKNLMRHGVQPDLGQSQKAPPMASLWHWAHLRVGSEGIRGNVMTKKN
GAKLTASQKALQNTFHNRVDSDSLLKKHQSYAARIDSPFTYLVMVQGIPIFTGSYFGAPP
PKSTEIFINAPERIRHHRTYITKHRRYPKETRKQKLMRRVRKSEDREKEKDKKRARKEQK
NQKVENLEQSTTASSTSSLSSPEITVSKKPEIKNDDKSKSKGWRHLANRIFKRKN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]