dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

CBG07369 (Caenorhabditis briggsae 2)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment CBP35639 WBGene00029434 locus:Cbr-twk-23 status:Predicted UniProt:A8X4X5
Sequence length 424
Sequence
MGKKKESMAKCAWMKFRNVLRIALGHLALYCFVVCYVFAGAWVFHQLEGENETELHDKQR
EYAMNLKKDVIAKLATTENVAEINEHLRMFLRNISNLHISLDNYLIFNEPSQVVPKRWTF
PSSVLFSFTILTTIGYGNVTPHTQQCKVFLMIYGAFGIPLFLITIADLGRFSKTAIMALV
QKVSKRELKKQSDEHLLREIAEVMLVAGLFVVFIAIGSAVIPLWENQLTYFDSVYFSYMS
LTTIGLGDIVPRRMDFLLPTLIYITIGLWLTTALVEQLADVFRLVHYAGRQVTNVKGITV
WLGGRRLSMGGLISTVCRRVGMSENLINQINWDRTVIDALDGKMPPTLPIFPWHFTDFLE
HDPPLIDLSIDLDQMDGSFYCSKPLSAKKQRRASQMSAPAIAWMRPQEEARILDADGNFP
NIDA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]