dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

CBG08124 (Caenorhabditis briggsae 2)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment CBP30337 WBGene00029983 locus:Cbr-sli-1 status:Predicted UniProt:A8X5V5
Sequence length 546
Sequence
MGSINTIFHRIHRFVNGGNNVRFVPNTTPAPETLTLNPRAMPSIVSDRRFLLKACKFMDQ
VVKSCHSPRLNLKNSPPFILDILPDTYTHLMLIFTHNNDILQDNEYLRLFLESLINKCKE
IIKLFKTSGIYNDQSDERRKLTKMSLTFSHMLFEIKALFPEGQYIEDRFRMTKKEADCFW
SQHFLKKNIVPWPAFLIALEKHHGAVLGKMEAAELKSTIDLSGDDFISNFEFDVFTRLFY
PFKTLIKNWQTLTSAHPGYCAFLTYDEVKKRLEKLTRKPGSYIFRLSCTRPGQWAIGYVA
PDGKIYQTIPQNKSLIQALHEGHKEGFYIYPNGREQDINLSKLMDVPQADRVQVTSEQYE
LYCEMGTTFELCKICDDNEKNIKIERADICYAQNDSDGGGNTCPFCRYEIKGTNRVIIDR
FKPTSAEIAKVAERKLIAIAPDIPPRTYVSQTQSLPHESHSIPSVDELPLVPPPLPAKTL
AVKEMMNTSQSSASYVNVRELENVATSSDGELSRQRAPSVLAPPLPPRLSILEPPRHEYT
NTSNLA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]