dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

CBG14128 (Caenorhabditis briggsae 2)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment CBP31837 WBGene00034726 locus:Cbr-twk-16 status:Predicted UniProt:A8XJD2
Sequence length 565
Sequence
MHNLQSKKQAFEVEHAKPFTLHCSLLMLVLLYSFLGGFVFDRIETDAHAEMKRNERTNRT
SCVSQILHSVHRWSRNYTHQEQLAEQIADCFEPEKDERSEWNFVTATLYGFGIVTTLGYN
RIAPITYTGRMFCIVYGICGIPVTMIIIANVGQYLNNFAGDSRRKIEAYRQQRRMSKASL
AGKVYKESSIQVTSLALLCVFLAYVGVGALLLPLLNGELDFFNGLYFNFLCLTAIDFGQL
VPIRVELLPITFLYVCIGLAITTIAISKRKFFKGDFLFFILDIGSEYMKKLHYWGKKMKN
AAQTRIWFGGKTLKVRDLLHAVGKKCGVEPGMIDALDLENVVERTIAIQEGREPPEDLND
EPREPSPRSIIHSPCSTRPSNPPMSPPSPREDHPFIFKMDTPAPRSPLPLPSYELDIKKP
IFQALSNEFMNQSAQEKLFDDLDTFHVELNTELVEDNKCESVIIIEPPATFEDMTVQSSL
NVEDYEKEEKAPKRFREKKEMYGRDPRKLYETYQEEWDRLERLSDRKHGPRRKSVLNLAT
CSPERSVSPSPIRHSLTGEDNRRNS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]