dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

MDP0000229344|PACid:22665895 (Malus domestica v196)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Sequence length 937
Sequence
MHVFSPGLTHTDPQKPHSPLITFVNAHCIELAAAASAVAGFGELEFGAMESKICMNPSCR
MANTHEWKTGWPLRSGGFAHLCYKCGVEYENSVYCNTFHSGETGWRDCNLCHKPLHCGCI
VSETLYECLDFGGIGCIGCASQPHVIQDGDVLNGFGGLKISDFGDHQSTVPQNGALSDTA
NEGELLQLCQVMEANESNLSSQSQRGEINVSPVQTKREEVTYPRGEVGPGFSSITRPSFG
SLTFAKPDNGRIMIEVKDMNKXSSEPSLSMTLGGPSATPNFAQPFTGGILERRDQSKMSS
SFQQGQKIRPIFPRPLRPPPPIHNVRVARPPAEGRGKSQLLPRYWPRITDQELQKLAGDL
NSTIVPLFEKVLSASDAGRIGRLVLPKACAEAYFPPISQSEGLPIRIQDVKGNEWTFQFR
FWPNNNSRMYVLEGVTPCIQSMELQAGDTVTFSRIDPGGRLVIGFRKASRCLDVQESQTS
FLPNGTPGETSCPSVVENLVTGSGHSSIYQMSTGSKDLNALSGHLHLADGDTSLHSNENH
SHFTSEDLQQKPVSNSDKKRARNIGPKSKRLLLHSEDVLELRLTWEEAQDLLRPPLSVKP
SIVTIEDHEFEEYDEPPVFGKRSLFIAESERQEQWARCDDCSKWRRLPVDVLLPPKWTCX
ENSWDINRCSCSAPEEVSQEELDNLLRPSKDLKKRRIVVNHNEAQEHEPSGLDALASASA
AILGDSVDYADEQSVGATTRHPRHRPGCTCIVCIQPPSGKGKHKPTCTCNVCMTVKRRFK
TLMMNKRKRKSEREMENAHXDNNDHKDESEMNGMSTEIELHMNHSSENGSSCEKRIQADV
AESSCAGQIDLNCEPKHNYVQVSGLTLLRLADAVAQQPVKNSTKESGLTNRMCEPQAGLG
SSLRAQDTAETDKLLCNEGSLSSVAAAWDLEGRGDED

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]