dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

MDP0000257606|PACid:22645914 (Malus domestica v196)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Sequence length 1062
Sequence
MVVPVFYQVDPSDVRKAKRSFEEAFAEHEGHSNTDMEEVRRWRDDVKLIEEIVKDIFQKL
IRTSSSKDDDLVEMDSHMHEMDLLLHPAPQMDDEEFSXCGAVHMQEKFLSRIXNEKVQSL
GTLDRGYRMILKRXQXKKVLIVLDDVDDXFQIETLLGKQHSFGGGSRIIITTRDKLVLSX
ADAIYSPKVLSGXGALELFSQYAFXTKQPKRDYDHLSSRAVRYAQGLPLALKVLGAFLYN
KSXQEWEEVLEKLKKIPQRGIHDVLRTSFDGLDDSEKDIFLDIACFFKGAEKDNATKATE
AVESIILDPSFSKPEVVYLSSEAFVKMTKLRLLKIHCDSGYSCENLKFLPHELRSLIWKH
FPLKSLPSNFIAKNLVELDMQNSLIEHLWEGAKPLENLKIINLTSSPHLKKTPDFTEAKN
LEKVVFRSCTSLLEVHPSISSLENLVLLDFENCGNLKIFPSRIGMKSLRTLTLSGCENLE
KFPEVSDVMQDLSVLYLNSAGIKELPSSISNLTGLLVLNINGCRNLEGFCRDHYPLTMPE
MEETDEDDDSGNSSWDDDEDSDCVEVLDNIIGKAAVAIRRATAFKSDNPSFIVPMKRNIN
GYSVWLPSKLCIHMRRLGKHSGAVILRVLDGRTWSVEMKCEIATRPKLRLQYGWTEFVRG
NNLEVGDVYVLVLIDDTKLVFEVVIFRATGTAHTFSPPDVDGEQTMSQTEETDEDDDSIE
ILDNFPRCSKTKKKSPTAPQPHKKNRTCSVSTAENRIKKFGGSSLTXKIMNRRTLQYLGA
KFTKEHFLKRNYHQVILRVSDGRTWPVKLSKRQKNMVRLQNGWITFVQDSHLEIGDVCVF
ALINNIKGLMDVVIFHTTEAARCNVSQDGEKPMSQTEETDEDDDCVEILDDSPPCLKTKK
NRVGSISTSETHMKKFGGSSWTKELVKRRPDQNLEAKFAXEHLLNRTHDNVILRVSGGRT
WPVKLHQYSKTVLKFQSGWMTFVQDNGLEIGDSFSAVEKXLIAPFHXVSKFSVGCEFLSA
PSVMRYVVFVLNLNLGGTGSXSPWTXEPLIQGNVTSLAHDLE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]