dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

MDP0000306147|PACid:22679041 (Malus domestica v196)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Sequence length 1635
Sequence
MVDKIDGKEKKSGLKIRSKFVEANMVDSEDDEPIGSLLTLKRQTNPKKVKGGGERGKKVD
DEEDDLGCLDDTLASLRKKLKGPKKDYGTGTMRGRSFALDSVQSAERYSNGHVDDGGLDG
KSVSRVLEKDPVMGDDGSDVTIGIEVENKLNGKGKRPKISGSLGFGEGSNCLLDHHPEDS
LSAFSRKSQSGLIMNSRASSXPKEKSGSKVLEDGLNTMPLAVQDVLGRCTSAADCATSSP
ARKGILRPRYNDDLLDKSCEDMSEDKQLIGDELGSDWCPKFSQRTQHQLSNFASNNLGME
DTRSNCNGLISYTKNPGLASGPLREENDVPNHDHLITSEEADENESFPEDTVSLPDVENK
NTKLSAVQRVGCIVKKRRHGDMAYEGDADWEVLINDQSLDSDNLRVKFDSSSSIGTESES
GEAAAVSTGLKAHAVGPVEKIKFKEILKRRGGVQDYLECRNQILALWNKDVSRILPLADC
GVTDTACADEPPRASLIRDIYTFLDLSGYINIGIAREKDKAESDPKHDYKILREKNFEEI
FGVSVADSEDGVSFITGQVKSSKTKIDAKSGVIIKSDKLTQEVTKDNGLVTTAALELSNT
KNHAEFEADHPENTSVDARLQSKLDNMDVSSIYPISETLGDGGIPHETPELKNVSHSTQC
ASQDHAVRNNNPQCCPEVKKKIIVIGAGPAGLIAVCNLQRQGFSVTILEARSRIGGRVYT
DRLSLSVPVDLGASIITGVEADWATERRPDPSSLVCAQLGLELTVLNSDCPLYDIATGXK
VPADLDEALEAEFNSLLDDMEVSLPNWNQDDVYGGFGGAHCXIKGGYSTVVESLGEXLXI
HLNHVVTDISYXTKDAGLNTNRXNKVKVSTSNGSDFSGDAILITVPLGCLKAETIKFSPP
LPHWKHSSILRLGFGVLNKVVLEFPXVFWDDSVDYFGATAEETELRGQCFMFWNVKKTVG
APVLIALVVGKAAIDGQNMSSSEHVNHAIVVLRKLFGEASVPDPVASVVTDWGKDPFSYG
AYSYVAVGASGEDYDILGRPVENCLFFAGEATCKEHPDTVGGAMMSGLREAVRIIDILTT
GNDYTAEADAIAGIQRQSDSERAEVRDITRRLDAVELSDVLYMNKEALLQDMFFNAKTTK
GRLHLAKELLSLPVETLKSFAGTKEGLTTLNSWILDSMGKAGTQLLRHCVRLLVLVSTDL
LAVRLSGIGKTVREKVCVHTSRDIRAIASQLVNVWLEVFRKEKASNGALKLSRQATAADA
LRRKPIKDPSSGKPPLHTFHGDLEHKGSLQDSASTASHLPLNANGKKVNGKPIKGETANS
SKSEINSSRFRGSTGRPHSELKENDVAVTEAEQAAIAAAEAARAAALAAAEAYASSEAKS
GTLLQLPKIPSFHKFARREQYPQMDEYDFRRKWSGGDLGRQDCISEIDSRNCKVRDWSVD
FSATCVNIDSSRMSVDNLSQRSNPNETGSQTNIREHSGESAAVDSSIYTRAWVDTAGSAG
IKDYHAIEMWQSQAAAVDPDFFHPEPYIHDEEGSNTTSRKHSWKHEGHVNEGSVSQVTVN
KESLKNHXRGADNIKQAVVDYVASLLMPLYKAKKIDREGYKSIMKKSATKVMELATDSEK
AMAVYEFLDFKRRNK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]