dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

MDP0000611628|PACid:22643604 (Malus domestica v196)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Sequence length 760
Sequence
MATCQLXAYGRIRSGIGTDTGGLAXFTSSTHQIMLAPLTTQVWDWEIIQQAMKDYYDKDM
ELLLQDILANITDGIWSDDVTSWKHCDDQRSCINKYATESINIACKWAYKGVEAGDTLTE
DYFLPRLPVVEKRIAQGGVRLAAILNRVFSSSQDTGVDDDTCKEDRERIHIRGKWFMKVG
PTEQNDTTMRXKEYLPLLLRGEVLNLNMAFERISRTARHGFRRSPSGASSRTTEKDMLCE
RASTXKYCSVPSLEREXRNNNLSYLSSISKVNHNSFWSRGISITPXYQFPSAERIVEESD
SECNDPKYPGLEATRPSEKPRVVVLGTGWAACRFLKGLDTKVYDVVCISPRNHMVFTPLL
ASTCVGTLEFRSVAEPVSRIQSALAXSPSSYFYMASCXGLDTDKHEVYCXTISNGGLSHE
PYRFKVAYDKLXIAAGAEPLTFGIKGVKEHAFFLREVNHAQEIRKKLLLNLMLSEHPGIS
EEERKRVLHCVVIGGGPTGVEFSGELSDFIMKDVQERFSHVKDYIKVTLIEAIRNKSLDQ
GKFGLPSNTXXYFLLILGMDLKCGPFHQVGVRLMRGVVKEVHPKKIVLNDGTDVPYGLLV
WSTGVGPSEFVKKLXLPKSPGGRIGVDGWMRVPSVEDVFALGDCAGFLEETGRPVLPALA
QVAEREGKYLVEXFNRIGKQDAGKAFSAKDIPLGEQFVYKHLGSMATVGGYKALVDLRQS
KPFVARKELKKPLPFPVTHSSKKYNSSTKNLDWLIDHHMI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]