dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|297563523|ref|YP_003682497.1| (Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein Ndas_4605 [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
Sequence length 608
Sequence
MRVLDQYGTVGGAVLLSPGLLVTCAHVVNAALGLHGEKEEHPGPLATVRLRSFDDRVWEA
SVDTRLWSAGPDSRDLAVLRLRDAGPDTSFPVLRECASLEPQQPLYTAGYPEGMRSLQAP
LVCQGPGGPTGVTHQVETPTSQPVRITGGFSGCAVRTGTGELVGIMQKTHHYVWNDPDRP
SGIAFILPVEELVGERDDGEVVSAQRLADESLCGREAYDRLHDLLDSVPLDAVPPEDLLS
PAEARKARRHGAGTTAWRVLTALWDLVPPVGEPPPRVAWVHHVYQEIRHQRPLPPAVWSW
IRQEAGPMGRDWEEALTRDRDRRLLRRREPDAPAAPSGHRDERPPDTVVLFELEPVTGGY
RLSHRIAHRGERDDPLPQGTRLVGEPQICDEIADLMGEATMQRLVTPNEESLRLRVLLPR
DLLHLNPGQASPHRDLLEYAPPLCTMYEIVYHVRERVRLPHYLGVPPDRWRLRCERQTAS
PLVEDRNVLASWKQEVSEVAIALSDQNVTVCVTDSDNSDVEHVYDSALYWGIPTIIRGPR
KAVTAFLEELLDREPDSRVRISGLARHLRDSARRSSQAREIAIIHDIFGDALLQETPGEP
AGPERPGV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]