dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|341582218|ref|YP_004762710.1| (Thermococcus sp. 4557)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein GQS_05665 [Thermococcus sp. 4557]
Sequence length 741
Sequence
MKKVLAAIMIVLMLIPAVGAGKIDGSVTFLSGASQSTKETREVSLALMALVSARDDVNWD
ITPDIDALVDELLDNQNQDGGWGHYFNEPSNVLDTAYAVIALTRAYPLMDVWKARDVERA
IDSGIDYLLSAKEENGWGYIPGTPVSCYPTVVALWALGENGYTYNSRTVRDAVRYLESIN
ASSCEISNYEFLALRVVAYHSTGYPLGSDVADQLKDILLKERMEVKERAMLTYALVLVSP
LDLDVARALKMLEKEGRSSDDIFYWMNTPSLMSQTEIIASTAFALMALSHPLKVTIPGEV
TNPYTMPCRELKYMQNLDGGWGLVLNEPSNEKATYYALLGLEKCYPTNESISKALEWARN
AFERDALWVQKNGRMSVGYYYALETLLRYNLLSEEEKASAVELIRNAQLDYGLWGNTVLG
PQPYETALAVKALLDLGVPANDPLIQAAKEWLLSISNGGWGTHVTTPHFSYMLKPDVLTT
ITVLEALENVATPEELEPHLQWLMDQRINGGWAYWKAYYVWQENREYPGTPSVELTVRAT
DMLLRYGHNYTSKTLDFVMNARDSGLIRNKPIETANAVLYLCRFQYIPPVSLNDVRAELD
SDIFEVIAPGMDNESVAEIVNRLSDTFSGGFIAANGTGIGEGSYIVLSNFSGYSIRVYNP
YLPFHIDGDNVTVGNVTVPLNKSVVLIPGKTPEGVVLFVFYEPENEGIAKDVFTTGFIKY
IGGSAMVLVVENGRIKVIAVG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]