dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

FBpp0072708 (Drosophila melanogaster 76_5)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:known chromosome:BDGP5:3L:1555363:1558484:-1 gene:FBgn0035232 transcript:FBtr0072828 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 708
Sequence
MDSNNSSNSKKQPQSSHHGKSSSAESQRKSSELHTNSNKQRHSRRRNQVPTPRNDQQQQP
QQPAKLRPNVDKRPKARGFGGGYDFPSPRGQDGASGSSRLAYSATGYSRSGDFDHELNSV
YTQGSKKQNLNHLLNFHCVPRELERGHHHQAQQHHGLSGRKQRYNKEQFLQANFQFVIRS
GAKAQVNGSPDALIDWSYIEQINIQTTEELQCPICLYPPVAAKLTRCGHAYCWPCLLHYL
SLSDKTWRKCPICYDAIHAGDLKSCTIEQLRDLQVGEKITFQLMRRRKGSMYIENHVAGL
GETIERFPFVSAGEEAKRYSKFLIAKRMDVAAIIERERNELLAESDVSCPEDVFIQQALV
MLQERVEKLGVEKPDPKEDEEETAPVLCLETETKIDIEKSDDASISSGEASSSLSYSSNH
NKYYYFYQSNDGQNIYLHPLNVKMLQACYGTLDLGPLLIEAQIVQMEQHSMDEEHRRKFT
CLGHLPLTCQFSVVEVELQPPVVTGGILKLFKEDILHRKKERQRRDREERKREQHINEIN
DRQMGKLIASAANLDLSSSHEFPTCGFEEALPAPSGSVPMNISNQDPGSRYSSVTLGSPK
QEMWPTIGSNSPGGGGAPLDVQVGAWGRSAPPPPRAVMVPRTSDEDFEQRSVGHWGLGEL
LVGALDQKKQKVGAAKSNGAAPAESKKQKKAKGKKMVPLFATGMNRAP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]