dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

FBpp0089297 (Drosophila melanogaster 76_5)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:known chromosome:BDGP5:X:7942563:7955469:-1 gene:FBgn0004656 transcript:FBtr0071120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 1110
Sequence
MSSSEPPPRYEPPVEPVNGIVQPPVIPPAERPGRNTNQLQYLIKTVMKVIWKHHFSWPFQ
QPVDAKKLNLPDYHKIIKQPMDMGTIKKRLENNYYWSAKETIQDFNTMFNNCYVYNKPGE
DVVVMAQTLEKVFLQKIESMPKEELELEPVTAKGGKKKQRAPATPKSSSGGAGASTGSGT
SSAAVTSGPGSGSTKVSVAASSAQQSGLQGATGAGGGSSSTPGTQPGSGAGGAIAARPVS
AMGGTVSSTAGGAPSIPPISTMPPHTVPGSTNTTTTAMAGGVGGPGAAGANPNAAALMAS
LLNAGQTGAYPGAPGQTAVNSSSLLDGSTAAVAAAAAAAAAAAAAAGGAAGAAGGAGTIP
AVAVNAANAVQAYVNAGVSVGVDAVIPPQQPAKIKKGVKRKADTTTPTANAFESPYTQMD
SKSAKIATRRESNRQDLTFQGSGYNMSPLGVSGVPGLGGLVAGGVAGVAVAKNKEKLSDA
LKSCNEILKELFSKKHSGYAWPFYKPVDAEMLGLHDYHDIIKKPMDLGTVKRKMDNREYK
SAPEFAADVRLIFTNCYKYNPPDHDVVAMGRKLQDVFEMRYANIPDEPVANAAHHHGHGH
GHGHGHGHGHGHGHGHGHGHGYGGSSSLKHDASDSSSEDSSDTENESNSDEERSARLKML
ESKLLGLQEEIRKLSEEASAKKKAKKKLKEKKKSIGGGSGSGSASHHCHATGGGANAGGA
GGPGSGGHGSVSVPGGVGSLGPGGAGGANLNALLGGSLVGHGGAAVAGGVPNVGALHSQV
HDVAMAFSQMAGGGAAAGAGFGAGVTAAGASSGGKAGTLAGALAAGAAAGAGGTTAGSGS
SKGAKSKGGRGAKGSGAGGVGASNNAAAGNAAGGAAGAAAGAGSVGGVGGAGAAGGGNAS
KRAKGSSSAGAGGGVGGANASAGGAGARGSSKKKPSQVMNFDSEEEDTAKPMSYDEKRQL
SLDINKLPGDKLGRVVHIIQNREPSLRDSNPDEIEIDFETLKPSTLRELESYVASCLRKK
TRKPYYKKPSGKSKDEQMAEKKQELEKRLQDVTGQLGASKKTAKKDESASSKVEAVQPAN
PVSSSSSSSDSSSSSSSDSSSSDSSDSEAG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]