dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

FBpp0071560 (Drosophila melanogaster FlyBase 5.12)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment type=protein; loc=2R:complement(17011623..17012507,17012568..17013349,17013411..17014524); ID=FBpp0071560; name=CG4050-PA; parent=FBgn0020312,FBtr0071637; dbxref=FlyBase:FBpp0071560,FlyBase_Annotation_IDs:CG4050-PA,GB_protein:AAF46676.2,REFSEQ:NP_477246,GB_protein:AAF46676,FlyMine:FBpp0071560,modMine:FBpp0071560; MD5=22244ddca711223f9ee03666c144a274; length=926; release=r5.30; species=Dmel;
Sequence length 926
Sequence
MSTNPNPGIHQYAPSTLPREREREGATNSPQRNLLEFLCICVACIVCYYNSTQCGLVFDD
ISAIRDNKDLRPHTPLINVFLNDFWGTPMRKEQSHKSYRPLTVLTFRFNYLLHALEPFGY
HLVNLLLHLSVCLLWRRVCRLLLRQCAASGSNAISAPSSSSVSQLNTCAFVASLLFAVHP
VHTEAVTGVVGRAELLSSICFLAAFLSYAKSVGDSGCPRRTNWLTLFGCFGSCLLASMLC
KEQGITIAGICVVYELFVVHQLRPLHLCHFVLRLFDERTEQQSPKLANPSGIRRWSSSTL
WKRLSFLVGITLTLLVGRVYVMGSQLPIFTRFDNPASAADTPERQLTYGYLIYLNCWLLL
CPSLLCCDWTMGTVPLLQGFTDSRNITTLLTFLALGAMVAKTCFTRNLALSRTLIMCLGW
MVLPFLPASNLFFPVGFVVAERILYMPSMGYCLLVAYGFEQLQRRGSLSWQRFSQAALAI
LLLTHALKTHQRNLDWRTEYSLFMSGVHVNQRNAKLYNNVGHALENEGKFEEALLYFQQA
VRIQTDDIGAHINVGRTFNNLKRYAEAEQAYVQAKALFPQAKPGVSYHARIAPNHLNVFI
NLANLIAKNQTRLEEADHLYRQAISMRSDYVQAYINRGDILMKLNRTAQAQEVYEQALLY
DNENADIYYNLGVVFLEQGKSQQAQVYFNKAIELYPEHEQALLNSAILLQELGGEEARRV
SRSRLYKVLENDDQNEKVYFNLGMLAMDESSFDEAEQFFKRAIHLKADFRSALFNLALLL
ADTKRPLDAVPFLNQLIRHHPSHVKGLILLGDIYINHMKDLDEAEKCYRSILHYDPHNTQ
GLHNLCVVFVERKRLAKAAACLQYAQRLAPAEDYIGRHLQIVLARLQKINKLPESAPERK
LAYEDYDPLEFKLPQDRPTHKSRKRS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]