dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

FBpp0072096 (Drosophila melanogaster FlyBase 5.12)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment type=protein; loc=2R:complement(19934806..19934844,19935028..19935382,19935449..19935519,19935589..19935783,19935858..19935973,19936162..19936229,19936292..19936356); ID=FBpp0072096; name=gammaSnap-PA; parent=FBgn0028552,FBtr0072187; dbxref=FlyBase:FBpp0072096,FlyBase_Annotation_IDs:CG3988-PA,GB_protein:AAF47147.2,REFSEQ:NP_477469,GB_protein:AAF47147,FlyMine:FBpp0072096,modMine:FBpp0072096; MD5=59fecce20b5cf02169119d617fc648eb; length=302; release=r5.30; species=Dmel;
Sequence length 302
Sequence
MSGIAAKKIAEAEDLVKQAEKSLKLSMLKWVPDYDSAADEYSKAATAYRIAKSYDKSKEC
FLKAIDAYKNNKSWFHAAKAYEQIILLSKDADKLHEVEEYANKSASLYQQHGSPEAAASA
LDKAAKLTESKHPDMALRFYQHALEVIMIEDSVRQAAEYASKVSRILVKLRRYDEATNAL
KKEISLNQQTESYGQIGRLVVALVMVQLARGDSVEAEKTFREWGNCCEPEEVSTLQTLLQ
AFDDEDPELAARMLASPFIRHMDVEYAILSKNIPLPQGIQMEKKAGDTAAETNDAEDEGG
LC

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]