dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

FBpp0072421 (Drosophila melanogaster FlyBase 5.12)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment type=protein; loc=3L:complement(234299..234504,234568..234652,234982..235345,235410..235514,235579..236074,236139..236427,239055..239185,239243..240667,240734..241057,241118..241501,241564..245475,245928..246216); ID=FBpp0072421; name=E(bx)-PA; parent=FBgn0000541,FBtr0072521; dbxref=FlyBase:FBpp0072421,FlyBase_Annotation_IDs:CG32346-PA,GB_protein:AAN11431.1,REFSEQ:NP_728507,GB_protein:AAN11431,FlyMine:FBpp0072421,modMine:FBpp0072421; MD5=9327fd34ad2fbe20b7a8313e1532ba56; length=2669; release=r5.30; species=Dmel;
Sequence length 2669
Sequence
MSGRGSRKRGRPPKTPNERASGRFNYQLLKKPKYLSEGKSQPSTPSASRGISPQSDEGSR
SSHNNHTNRSRGSAAKRGRGRKSAVQPNTSSYSGRKGYESEYHYGSDFGDSEEDKSDNED
DMLLTPSDDESLEVANESESEFSVCSFNQNGVGRPPRPPSPEPVWLQEGRQYAALDLPDS
SEDLFIANTHVLRALSIYEVLRRFRHMVRLSPFRFEDLCAALACEEQSALLTEVHIMLLK
AILREEDAQGTHFGPLDQKDTVNISLYLIDSITWPEVLRSYVESDKTFDRNVFHILSHTE
YPYTGIDNRLEVLQFLSDQFLTSNSIRDVMLQEGPIHYDDHCRVCHRLGDLLCCETCPAV
YHLECVDPPMNDVPTEDWQCGLCRSHKVSGVVDCVLPQEKQGVLIRHDSLGVDRHGRKYW
FIARRIFIEDQENFTCWYYSTTSKLKLLLSRLDAEELETRLHSQITERRDEIERQMKLTE
TLTNEHKHTKRSVIEIEQEAKNELLEKEVLDEDEKDGDAKSESQSIEGTKKQEECKMVTR
QKSNQLTNGTLHFKLGMEQGFKNYVNQYSTNPIALNKPQRNEERDKRRHLSHKFSLTTAS
DFKWIGITMGTTDNMITTLRQTLINFESNIAASFLNINWVVNKKIWNAAVMNARRPSEFA
VVLLLFQASLKSVVFANVWHEQLGHTTLQRITSAEREERKKLEKREKRERDDEEERNRLA
FNYIKYTLGLKHQVWKQKGEEYRVHGQWGWLWLSSSRRCGVRARRAQPLTHNRVYVHYTM
GEENDVNEIILVDPRTQRFMQQCESSNVDGQVCHYLPDQYKNVKVIEDVTEKIKGHIDVS
KALNAPGRTYYSKVARKSRLDDLLDRRLKLAEVEEQMASKIPSDMKPLLVSSQNNTANSK
QTFLEKRLLRLTEVQAKGGPANVNLELVNSLAKQIQTVRLQFSQLNRFAKVFRCYTKECN
TNSNAVSQITQNTCYSPLCLQKARAKKELLLLLRKAHTAGNGSKETVAAILGAVKKPSIL
EQKLTEGKRESTQVAVDDSEEGKPAESEAPLDLLQDWEHARAHAVPFSDSLLTECILVDQ
ECVTNTKIKQEVNASSGCNTTPDSNTQDSDKIDYIESMDVCSNVEIESTEDSIVTGLNSG
NAEDVDMTPGWRRKRNQKSKKSYIGTKDVLDQTLDKDIPLNKQNRRFPITARPVKRECVK
KYERETFENGNERVYSTSSPRGRVYLLNDAAKLYEQAVKTEDKSTITKKPSYSRYPLISN
FLTHKKKRSLLVLPRFELLKLARLGGKSSTNGFHHAAKNNTIWQYQCSRPLFRTCWSYRT
SNATSLSSLALQLRILWSCLRWDDMIAKPPSTDGKHQVTTDTEIVTLELLKLRHSGRYGE
KTSYLRRKVVIPLEMPKTVREVTSIRSGLRKRKRAESPQPTEPQITEEWVDEDKLELWEI
KFMGEKQEKARLSAVTRSVASRQLEASGSNGSNTSTNGALGVAGRVQLAPKLSEDVKEKM
EQQLKLQRAVHQQRKLVATGEITRSVTPVKGQVIGSRRVIVKNPDGTTRIIQQAVTQVSR
TGGANTAAAAASPTVGGSTSTQSNPSTSTPHKVQIIRGPDGKVSVRGLNPGQQLVQMPDG
KLHVLTTTTSSNSAGQGNKMKVPIKPASTSSSPAISSAQTTTNPVTPVIKQIAVKHVTKN
SATQSIASSSRVALPLAQIKNKLLLAQQQQQSTSSSPATSSSPVQKIVSKVVNTSTSGQT
LQQVFVQSGSKLVVGQNAQGQKVIISTSAAQQQGTSPVQQQQLVQSQPIQQSPQQISMTQ
VGNQPTQKVIQQIVNTSNVQQQIVVGGQRIILSPGQTIVTQRNVPQSQALQMVQQQIQTQ
QQQQQHHVVQPQQQFVVQSNQIVQSSPSAQTKLVKQLVVQQQSQQTIEEKTQITTTDSNE
TGTQQVLVPNSTLAQQLAQGKLQVATVNGQQVIVKPLGNNQAQIVAHIKHQGDGNAHIVT
SNSATAVPQANPQTSPVKQQALPPQSPQQVVVQQQQIHQQSPTNFESGVTPITQQPVLTQ
AVQAPAQQQALSVEESLLQNQPPGTVIKCVTAQVLQTEHGPRIVLQGLVGNDFTAQQLQL
VQTQVKQQLMKAQESNGKLGVLGPTKIYLAVQPENAVQSQPPPLTPVHQSAAHQQTNNIE
IDADTLATTYEANSTIKDIAINNGDDQENSKCAETENSNITTNESFAGTSSLLEGSEHDE
PTNLAGLDISETDLENKQNESFVVTRGYIQKSISNALKQGNLSPELEEKLVCMQKQQENA
NSTNEWETCSRGSVNEEALTPSRQTDDTEWKIRTSLRRPNAMTTSSQFNRILKKNRSKND
EVAELGEQKQSQLERHKELLKKNILRKRSLLERNLQSEIHEDVKTKVQRHVRPLSNASPD
EQSENERSGEPNLDFKRTEVQNPRHGAGRPKKLTRKKEKLYCICRTPYDDTKFYVGCDLC
SNWFHGDCVSITEEASKKLSEFICIDCKRARETQQLYCSCRQPYDESQFYICCDKCQDWF
HGRCVGILQSEAEFIDEYVCPECQRKNDANAANMKKLTSNDVEELKNLIKQMQLHKSAWP
FMEPVDPKEAPDYYKVIKEPMDLKRMEIKLESNTYTKLSEFIGDMTKIFDNCRYYNPKES
SFYKCAEALESYFVQKIKNFRENVFDQRT

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]