dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

FBpp0072562 (Drosophila melanogaster FlyBase 5.12)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment type=protein; loc=3L:join(1307700..1307741,1307804..1307902,1307964..1308899,1308957..1309793,1309857..1310314,1310628..1311708); ID=FBpp0072562; name=CG2469-PA; parent=FBgn0035205,FBtr0072669; dbxref=FlyBase:FBpp0072562,FlyBase_Annotation_IDs:CG2469-PA,GB_protein:AAN11469.1,REFSEQ:NP_788448,GB_protein:AAN11469,FlyMine:FBpp0072562,modMine:FBpp0072562; MD5=6c6b10a922915c1036b38200b4c43a40; length=1150; release=r5.30; species=Dmel;
Sequence length 1150
Sequence
MSNCIEIPLQDTDEVIEVDPDQLPDCPEVLSILKQERAPLHVWVNVALAYYKQKKTEDFV
TLLEESRSDDATKEYRDSDKDLMRALDMLAAHYVQEAYREKSKDKKRELFMKATNLYTSA
DKIIMYDQSHLLGRAYFCLLEGDKMDQADAQFNFVLNQSPSNIPSLLGKACIAFNRKDYR
GAMAFYKKALRTNPNCPANVRIGMAHCFLKMGNPEKAKLAFERALQLDQQCVGALIGLAV
LKLNQLEPESNKLGVQMLSKAYTIDNANPMVLNHLANHFFFKKDYQKVHHLALHAFHNTE
NEAMRAESCYQLARSFHAQSDYDQAFQYYYQSTQIAPANFVLPHYGLGQMYIYRGDTENA
AQCFEKVLKIQPGNYETMKILGSLYAHSNSQTKRDMAKTHLKKVTEQFPEDIEAWIELAQ
ILEQNDLQASLSAYGTASSILRDKAKYEIPAEIQNNVASLHYRLGNLKMAKLTLESALKH
ATSEMDKDVKYYESIQVTMKYNLARLNEAMSSYDVADKLYKEILKEHPNYIDCYLRLGCM
ARDKGLIFVASDFFKDALNINNDNPDARSLLGNLHLAKMQFALGQKNFETILKNPSTSTD
AYSLIALGNFSLQTLHQPSRDKEKERKHQEKALAIFKQVLRNDPRNIWATNGIGAVLAHK
GCVIEARDIFAQVREATADFCDVWLNIAHVYVEQKQYISAIQMYENCMKKFYKHNNVEVM
QYLARAYLRANKLVDAKAVLLKARRVAPQDTVLLFNIAVVLSRLAMAILKDEKSTLEIVL
QAVHELELAQKYFQYLSVHGDKNRFNIEVAGIEASTCQDLLSQAQYHVGRARRIDEEERS
LRRKQEEEREAFKIKVAEQRKRREEEAKTSRDQLLAKRQEYVEKTKNMLIIADAPPEKER
KKGGGRGRKDDYISGTESDNDGARREGERPSKKKGKGERKKGGGRKRKTEKYESDSEEEP
GASGKSGKKKGKKPKPVKESKEKLSAKQRLKVLSKETISTSESESDGKRSKSRSRSRSRN
RSGSRSGSASRSGSDREASRKRSRSRSGSGSGSDSDEATKRKRARNRIESGGESDRSGSR
ARSKSSSRSRSRSKSGSRSRSRSKSGSRSRSRSKSGSRSRSRSPSGSRSRSRSGSRSKSE
SRSRSGSPEK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]