dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

FBpp0073827 (Drosophila melanogaster FlyBase 5.12)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment type=protein; loc=X:join(15228684..15228707,15229023..15229301,15229383..15229513,15229579..15229762,15230323..15230594,15230648..15232055,15232105..15232737,15232870..15232957,15233660..15234048); ID=FBpp0073827; name=HDAC6-PB; parent=FBgn0026428,FBtr0074010; dbxref=FlyBase:FBpp0073827,FlyBase_Annotation_IDs:CG6170-PB,GB_protein:AAN09661.1,REFSEQ:NP_727842,GB_protein:AAN09661,FlyMine:FBpp0073827,modMine:FBpp0073827; MD5=c3389620b8f0c072ee5020702ef13cc0; length=1135; release=r5.30; species=Dmel;
Sequence length 1135
Sequence
MLRDIWIQSPPIVTRRSAQQAKIQTRAMASKSKTGTTGAATAAGGTGSSSGSISGGFNAA
DPRKSNKPNAALLEAKRRARNNMLKNQGCGSQESVTDIFQNAVNSKSLVRKPTALIYDES
MSQHCCLWDKEHYECPERFTRVLERCRELNLTERCLELPSRSATKDEILRLHTEEHFERL
KETSGIRDDERMEELSSRYDSIYIHPSTFELSLLASGSTIELVDHLVAGKAQNGMAIIRP
PGHHAMKAEYNGYCFFNNVALATQHALDVHKLQRILIIDYDVHHGQGTQRFFYNDPRVVY
FSIHRFEHGSFWPHLHESDYHAIGSGAGTGYNFNVPLNATGMTNGDYLAIFQQLLLPVAL
EFQPELIIVSAGYDAALGCPEGEMEVTPACYPHLLNPLLRLADARVAVVLEGGYCLDSLA
EGAALTLRSLLGDPCPPLVETVPLPRAELAQALLSCIAVHRPHWRCLQLQQTYDCVELQD
RDKEEDLHTVLRHWIGGPPPMDRYPTRDTAIPLPPEKLTSNAARLQVLRAETKLSVPSFK
VCYAYDAQMLLHCNLNDTGHPEQPSRIQHIHKMHDDYGLLKQMKQLSPRAATTDEVCLAH
TRAHVNTVRRLLGREPKELHDAAGIYNSVYLHPRTFDCATLAAGLVLQAVDSVLRGESRS
GICNVRPPGHHAEQDHPHGFCIFNNVAIAAQYAIRDFGLERVLIVDWDVHHGNGTQHIFE
SNPKVLYISLHRYEHGSFFPKGPDGNFDVVGKGAGRGFNVNIPWNKKGMGDLEYALAFQQ
LIMPIAYEFNPQLVLVSAGFDAAIGDPLGGCKVTAEGYGMLTHWLSALASGRIIVCLEGG
YNVNSISYAMTMCTKTLLGDPVPTPQLGATALQKPPTVAFQSCVESLQQCLQVQRNHWRS
LEFVGRRLPRDPVVGENNNEDFLTASLRHLNISNDDATAAAGGLAGDRPDCGDERPSGSK
PKVKVKTLSDYLAENKEALEQSEMFAVYPLKTCPHLRLLRPEEAPRSLDSGAECSVCGST
GENWVCLSCRHVACGRYVNAHMEQHSVEEQHPLAMSTADLSVWCYACSAYVDHPRLYAYL
NPLHEDKFQEPMAWTHGCAWREDGCYATGPDGRDEDDDDDNGAGSSICLRLERNN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]