dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

FBpp0074211 (Drosophila melanogaster FlyBase 5.12)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment type=protein; loc=X:complement(17340568..17340872,17340943..17341088,17341183..17341658,17341960..17342352,17342438..17342734); ID=FBpp0074211; name=p-cup-PA; parent=FBgn0030840,FBtr0074437; dbxref=FlyBase:FBpp0074211,FlyBase_Annotation_IDs:CG12993-PA,GB_protein:AAF48730.1,REFSEQ:NP_573216,GB_protein:AAF48730,FlyMine:FBpp0074211,modMine:FBpp0074211; MD5=c331cbbcb46fc5f53e122d989915512e; length=538; release=r5.30; species=Dmel;
Sequence length 538
Sequence
MSWTSGLYKSLLLRSQQSLVRPDLALLDIQISKRAIETMFGHRRELSFNHSHTADIIAKK
CEELFNANEFENALTTLYTDGRPFGGQFAHGRFEMIKQRSLAVFEDTLGESLRPFMHQHR
DVLEQINRRQKELAAHVSRPLWKKLRDQQQCDVQSIIIKERPQLTLLEKARRRASESLYN
HNYLGRSAVDIALLRQLRSDRNFLDPLRLATTPPMRKLTRRQFTIVRRLMKMLQARNPLY
NRRYVQQRHGPIADQERRRWQEMHLFHAQYQTRRDCMRMLHEVHKRRREGDVEKLSDYVE
NIMSGFIEYKTHRTLPWKFEFINEVYNILALAYCDKCAVPANVDFLQAQNRPILYLLRTE
KLHDMSVQFGGPNIYVEIEKEDERHSRISQKLEQLENRLRHSRFAIERSYLLFEIARCHF
QESRFDKCLVVARKAFNEARSCNCLIWRFNSIFLGCQVHAVLNRFERLKESLAKASQLAS
ELQAPKLVAYIAICINVNNYDLALQRIRQSDGNKRKSRKRSPVSTITSNSSQGSMSST

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]