dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

FBpp0074243 (Drosophila melanogaster FlyBase 5.12)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment type=protein; loc=X:complement(17742674..17742794,17742852..17743087,17743150..17743378,17743447..17743743,17743809..17743843,17743941..17743988); ID=FBpp0074243; name=CG15814-PA; parent=FBgn0030873,FBtr0074469; dbxref=FlyBase:FBpp0074243,FlyBase_Annotation_IDs:CG15814-PA,GB_protein:AAF48770.1,REFSEQ:NP_573247,GB_protein:AAF48770,FlyMine:FBpp0074243; MD5=2b92d522cbd287c04e5c1e2ec9c0cbcb; length=321; release=r5.30; species=Dmel;
Sequence length 321
Sequence
MHQEHMDLHEPVDLNKSLDEMTPEERMRAQHQLMVEKHRGHDAMHSEMVIILFVTLVIAQ
IILVEWKKRHYRSYAFVTLLAMWLIPLIISCSFGWLRFIIIWLVFTCITALVMRRAISKP
IQGTTPRLVYKWFYFIYKLSYGLGLVGYLVIIAAFLGMNYMFSQPPNTWMDVGLMFCFYG
LYIGVLGRDISEICSDKMAAAIGYYTPQGIPTRHLDQNVCAVCGNQLLVSEKEEGVIENT
YKLSCNHVFHEFCIRGWCIVGKKQTCPYCKEKVDLQKMFRNPWEKPHVLYGRLLDWIRWL
VAWQPLIFFIVQGINWMLGLE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]