dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

FBpp0074870 (Drosophila melanogaster FlyBase 5.12)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment type=protein; loc=3L:join(18598572..18598774,18598833..18599135,18599220..18599404,18599472..18600088,18600150..18600449); ID=FBpp0074870; name=CG18233-PA; parent=FBgn0036795,FBtr0075103; dbxref=GB_protein:AAF49254.2,GB_protein:AAF49254.1,FlyBase:FBpp0074870,FlyBase_Annotation_IDs:CG18233-PA,REFSEQ:NP_649044,GB_protein:AAF49254,FlyMine:FBpp0074870,modMine:FBpp0074870; MD5=859b4e54ef888084bcd67f2236f35475; length=535; release=r5.30; species=Dmel;
Sequence length 535
Sequence
MLNVVRAAAVLILVQSIHSTDPNDFLNRKYYSSSVLGLVKLLKMEQEFMVNFSIYANILQ
EKVDNLNIFLDALKRPNHKTHNEREKFVSNPLNAFGLIRRLNQDWPKLQNYTQKPLGLEQ
LTAMQDIVSAAPESFDMNEKLKAMHRIETTYDLQPKDIAKGLLQRTEFNYRLLFRDCLAL
AYHKFEIGEFKRSLLWFQEALKLSTDGSLEIMNRLKEIELKGFATAVAKRSIYLSNQGLT
NETIDDMANSQLQDAKLMDLEQLISSELKQWINDDSTTPPTDHNLGCRGLFPKKSNLVCR
YNSSTNAFLKLAPLKMEEISRDPYIVMFHEVISDKDIEEMKGEITEMENGWTSLGDPKEI
VSRVYWIRKESSFSKRINQRISDMTGFKLEEFPAIQLANFGVGGYFKPHYDFYTDRLKEV
DVNNTLGDRIGSIIFYAGEVSQGGQTVFPDLKVAVEPKKGNALFWFNAFDDSTPDPRSLH
SVCPVLVGSRWSEYYEKMLYSSRHNYEYILSAITKWLHYAPQLFVKPCSPRVHLE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]