dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

FBpp0074918 (Drosophila melanogaster FlyBase 5.12)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment type=protein; loc=3L:complement(17902849..17904307,17904369..17904871,17904926..17905296,17905348..17905411); ID=FBpp0074918; name=CG5290-PA; parent=FBgn0036772,FBtr0075152; dbxref=FlyBase:FBpp0074918,FlyBase_Annotation_IDs:CG5290-PA,GB_protein:AAF49283.1,REFSEQ:NP_649026,GB_protein:AAF49283,FlyMine:FBpp0074918,modMine:FBpp0074918; MD5=8bf5d5461355ff2f8e73f5b0ff83e6d0; length=798; release=r5.30; species=Dmel;
Sequence length 798
Sequence
MVADIFSEYYICNFNDAVTVEDLPADETLRQLWTRQKLWTIDELREILQRWQEHVKPDPN
DNPTSQLKDFLLLIFAFVQNSFTGPFDKLEEYQQIHSELELEKLDALEKLKASGEELNPN
VKSVELLLIAREILEGLLENHPESKVLIWWRLRLICLHQHVLDDLAASLYEQFKSAAGHL
QAHFNQFESRELQSLLLLELANGYLQFHRSEIASQILDELCKHLQVELKVEGLLGVRTKF
QQKALPQLCLKVEHLNEQQPLPPAVQTNETTKLPKLLLLEDDTRLERIRFVELKDNEVMT
LPSVLQALVLAKVKQLKRSTPKDRLADEQLEPYTQTLLYQEHGPFQVRQSALLLNCLQES
NQRRTVERSWKQCEECVKLLDTSEEELSLRSRLSYGFAAHLSPKWQVQLQLVDLLRSLGM
TKTALDICLRIHAWQQVIECYTSLELRHKAAEIIRQELEKKPTALLYCLLGDAIDDPSFY
EQAWLYSKKTSGKAQAYWGNHFYRSADYAQAMDHFEISLEINNLQEAILLRCGYCAIQLE
RWEPAVKYYLAYTHLEPNGFESWNNLAKALIKLGDKQRAHRVLGEALKCNYSNWKVWENY
MLVSVDTSHWDDAMRAYQRMAELKQHYLDQEVLTRIVYGVSKEDPAGSSALIKRLIKLLG
QQSIQHGNEPLVWELAALVAQTPLKKAEKLVKSYRAYTPKHLGWETKSEHALKALDLCLE
VCDLSVAAITEHIQEESEVMITSQLNSARLAGTSCLNALKRAINVDVSAEQTAKVEQLEK
RIEDLTKIVQERMNASRS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]