dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

FBpp0075683 (Drosophila melanogaster FlyBase 5.12)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment type=protein; loc=3L:complement(12739913..12739930,12739998..12740303,12740375..12740854,12740921..12741041,12741156..12741757); ID=FBpp0075683; name=Klc-PA; parent=FBgn0010235,FBtr0075951; dbxref=FlyBase:FBpp0075683,FlyBase_Annotation_IDs:CG5433-PA,GB_protein:AAF49890.2,REFSEQ:NP_524049,GB_protein:AAF49890,FlyMine:FBpp0075683,modMine:FBpp0075683; MD5=cb073bf402c9d10585722a5eec5912c3; length=508; release=r5.30; species=Dmel;
Sequence length 508
Sequence
MTQMSQDEIITNTKTVLQGLEALRVEHVSIMNGIAEVQKDNEKSDMLRKNIENIELGLSE
AQVMMALTSHLQNIEAEKHKLKTQVRRLHQENAWLRDELANTQQKFQASEQLVAQLEEEK
KHLEFMASVKKYDENQEQDDACDKSRTDPVVELFPDEENEDRHNMSPTPPSQFANQTSGY
EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLERTSGHDHPDVATMLNILALVYRD
QNKYKEAANLLNDALSIRGKTLGENHPAVAATLNNLAVLYGKRGKYKDAEPLCKRALEIR
EKVLGKDHPDVAKQLNNLALLCQNQGKYDEVEKYYQRALDIYESKLGPDDPNVAKTKNNL
AGCYLKQGRYTEAEILYKQVLTRAHEREFGAIDSKNKPIWQVAEEREEHKFDNRENTPYG
EYGGWHKAAKVDSPTVTTTLKNLGALYRRQGMFEAAETLEDCAMRSKKEAYDLAKQTKLS
QLLTSNEKRRSKAIKEDLDFSEEKNAKP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]