dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

FBpp0076114 (Drosophila melanogaster FlyBase 5.12)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment type=protein; loc=3L:join(9623321..9623402,9623480..9623724,9623918..9624238,9624293..9624796); ID=FBpp0076114; name=CG8336-PA; parent=FBgn0036020,FBtr0076385; dbxref=FlyBase:FBpp0076114,FlyBase_Annotation_IDs:CG8336-PA,GB_protein:AAN11947.1,REFSEQ:NP_648338,GB_protein:AAN11947,FlyMine:FBpp0076114,modMine:FBpp0076114; MD5=e540a3a8a8bf9274778bbd9c311b2a71; length=383; release=r5.30; species=Dmel;
Sequence length 383
Sequence
MEERKLLRAVKSTNPLVYLDISIGKEDAGRMIIELRKDVVPKTAENFRALCTGECGIGTL
GKPLHYKGTKFHKIKRVFVVQSGDVVKNDGSSGESIYGPVFDDENFELSHNEEGVVSMAN
YGKPNSNNSQFFISAAGCENLNGTNVVVGRVLRGLGIVAEMEQNCTDEGDPTAPIVIRDC
GEIAHNEDWGIECNDETTDKLPAYPQDWPRKLDKFTGDGAVELLTGIRQSGNHFYQLGRY
HEARAKYRKANRYYHYLSRQFGWQQLNPLKKHLVDEDLLKVDGFSVVNNINAAAVDLKVG
NYTSAREVCNEAIRLDPKCSKAFYRRAQAQRGLRNYEEAINDLKTAHNLLPENKQILNEL
NSTKQLLAQYNRQQRNALKNLFA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]