dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

FBpp0080449 (Drosophila melanogaster FlyBase 5.12)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment type=protein; loc=2L:join(16738996..16739194,16740572..16741304,16741366..16741888,16741947..16742225); ID=FBpp0080449; name=ChLD3-PA; parent=FBgn0032598,FBtr0080892; dbxref=FlyBase:FBpp0080449,FlyBase_Annotation_IDs:CG17905-PA,GB_protein:AAF53561.2,REFSEQ:NP_609806,GB_protein:AAF53561,FlyMine:FBpp0080449,modMine:FBpp0080449; MD5=a4c9baa2e793c312f001f0d828cf6740; length=577; release=r5.30; species=Dmel;
Sequence length 577
Sequence
MLCPGENAYNANGQTGFTVKVVASAQRRSKPQPTARIPNAHRLPSLCIWMMVALMIMSSS
LDALVIDNDGIVGNQTRHRRSTSGAASCMQDARFYRNPNRPVHKIWTNSECAKYFLCLDG
EVFEFKCSEGLLFDVVRQICDFKANVDNCDVSAETPAPKPLLEMADCADEYQLGCADGTC
LPQEYFCDGSVDCPDGSDEGWCDVEHDPNAAGACDPRKCHLPQCFCSKDGTQIPGSLPAQ
SVPQMILLTFDDAINHDNWELFSKVLFTQHRRNPNGCPIKGTFYVSHPFTNYQYVQKLWN
DGHEIAVHSVTHRGPEMWWSKNATIEDWFDEMVGQANIINKFAAVRMEEIRGMRVPFLRV
GWNRQFLMMKEFGFVYDSSMVAPHSNPPLWPYTLDYKMPHSCTGVNQNCPSRSYPGIWEL
VMNQLEVGEYMCGMVDTCPPHLSGEDVYRMLTHNFKRHYLSNRAPFGLYFHSTWFKKVDY
LNAFLKFLDDLQKLPDVFFVTNQQAIQWMRHPTPSNQLHQFESWHCQPKDLDPHEQVCNT
PNVCKVRSRVLQEDRFFYTCMECPAQYPWIRNEFGLD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]