dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

FBpp0080475 (Drosophila melanogaster FlyBase 5.12)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment type=protein; loc=2L:join(16827724..16827889,16828052..16828552,16828617..16828795,16828857..16828946,16829003..16830460,16830524..16831378); ID=FBpp0080475; name=CG31739-PA; parent=FBgn0051739,FBtr0080919; dbxref=FlyBase:FBpp0080475,FlyBase_Annotation_IDs:CG31739-PA,GB_protein:AAF53577.3,REFSEQ:NP_724018,GB_protein:AAF53577,FlyMine:FBpp0080475,modMine:FBpp0080475; MD5=a43607e7f5beff9a11d4ef9f624fd0fb; length=1082; release=r5.30; species=Dmel;
Sequence length 1082
Sequence
MSGRYRGGGGGRFGGRGGGGYADGGGYNDFDNYRGGGGPGFNDNFGPGPGPNPFNMGGPN
ISGNELMQLMSAMASNFNMNSQPPQPMRQSCGELRNHHCGLFVELSGRLIKKRVNRFAEL
RDRNGGACQLVVLEDKHPRVARRMNNMPENTTLTIVGLVMRRPHNSCNQTMPTGEIEVEV
QDILNIHFPAGGTKRAGDKRTYSTMVQQQSNLGITSTEYKIAKNENILKYFENRDLTCND
LRRDDVGKTVTLVGWIPSTKNNKFLQLKDGYGQTQLMIEDQSLSDTFLSTPEQTVIQIVG
KVLGRPKANVNLKYDTGEVEVSVTSVKVLNPDDPYDGPIKAKEKKQKFSIDDLEAEEAAA
EASANLTSNNGESTEDSAEASTTANASLIAEQRAKVADTNKFADRTHNCGELTSNDINEK
VVICGWLEFQRMNKFFILRDAYGQTQVLLSPKTYGLEEYAETGVPIESIVRVEGTVIPRP
AATINPKMQTGHVEVEADKVVVLNPAKKNLPFEIRKFNRAGERLRLTHRYLDLRFNDMQH
NLRLRSAVIMKMREYLINYLGFVEVETPTLFRRTPGGAQEFVVPTRKAGHFYSLVQSPQQ
FKQMLMSGGIDRYFQVARCYRDEATRPDRQPEFTQLDIELSFTSRDDIMQLIEETLRYSW
PKDFPRLQTPFRRITYEEAMEKYGNDKPDTRFGFLLNNVSEIIEKSDEFKEKYDDLGAYA
IVVRASEAFWNGAARKHYESLGKEFKGTLFVRKFGPTKDVQEKLGKLLGEDVATEVADKF
DLEENDLLFLGIGSKVETRELLGRIRLDYQDFLVENAKIKKPNDFRFLWVIDFPLFERNR
ETNQLESVHHPFTLPHSDDLENFATSCENLESIRSQAYDLVLNGQEVGGGSIRIHDRDMQ
HFILEQILKIPHDHLSHLLSALESGCPPHGGIALGLDRLIAILCRARSIRDVIAFPKSLN
GRDPLSNAPVPISDEEMRLYHLSVVDEEEPSTNNTSHEQEDDDPDQERAPPSPMSATSES
EQPQINVDIKQEPEGLNEDFAPESPATKSTVKADPDEPSPSNPLASEAATPARARRTVKK
KV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]