dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

FBpp0080535 (Drosophila melanogaster FlyBase 5.12)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment type=protein; loc=2L:17473588..17474583; ID=FBpp0080535; name=Sgt-PA; parent=FBgn0032640,FBtr0080982; dbxref=FlyBase:FBpp0080535,FlyBase_Annotation_IDs:CG5094-PA,GB_protein:AAF53617.1,REFSEQ:NP_609842,GB_protein:AAF53617,FlyMine:FBpp0080535,modMine:FBpp0080535; MD5=73f1081d3ef766dae5c78df51feb077d; length=331; release=r5.30; species=Dmel;
Sequence length 331
Sequence
MPDAVQQSFVRSFIDYLKKQGDVMSPDQTESIEVAIQCLQAAFDLGDDVEAAPAAAGEEQ
ATTQSSSTASAPDDDAVASGSAGIGAAAAAVPNNIDMFELFQSLYTERNPESLALAESIK
NEGNRLMKENKYNEALLQYNRAIAFDPKNPIFYCNRAAAHIRLGENERAVTDCKSALVYN
NNYSKAYCRLGVAYSNMGNFEKAEQAYAKAIELEPDNEVYKSNLEAARNARNQPPQTGRL
REDLINMLSQPMVRNLFNNAEIDVEQLLSMLQNPMIMNTIRQQFGGGNAPTLPNDMVQMI
YNMTSQLTGFPNSNANPGNEQQPGNQPPPST

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]